Browsing All Linkers
Browse by:
  
  
  
  

2259 results found. Click on headers to sort table. Hold shift to sort by multiple headers at once.

This website requires Javascript in order show the linker conformation, and to add linkers to your list of favorites.

SynLinker Entry PDB sequence Linker Information Structure Selected
Linkers
Accession Name Start End ID Residues Angstrom Solvent
Accessibility
Flexibility Sequence Show/
Hide
Add/
Remove
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
1171241821.240.0322945.404
ITTPKDDE
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
1311392915.6440.0268374.5404
HDITPSMTP
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
1471523612.9440.0248682.5606
AGTLLP
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
16517441027.3690.0365145.096
AEATVAPVSP
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
1761815613.4010.0261062.5556
LAPYKV
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
1831936114.9990.0442226.2727
IDALADKYEPS
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
195197735.4640.00793290.75758
FTH
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
2062128713.4270.0334765.4495
ESIKDDK
show
19HCA
PROTEIN (NINE-HAEM CYTOCHROME C)
217223979.4330.021383.9242
FHDKPEI
show
1A0IA
DNA LIGASE
2392431511.5430.0121013.6616
MKPEN
show
1A0IA
DNA LIGASE
2532672155.3010.0593067.6717
VWGTKGLANEGKVIG
show
1A0IA
DNA LIGASE
271277374.6210.0322293.3131
LLESGRL
show
1A0IA
DNA LIGASE
2812864612.830.0131192.9596
TNISRA
show
1A0IA
DNA LIGASE
29932652841.3680.09806512.586
TLSQWGFFSPYGIGDNDACTINPYDGWA
show
1A2OA
CHEB METHYLESTERASE
10611611111.4870.0518696.1566
TKPQLGIREGM
show
1A2OA
CHEB METHYLESTERASE
132135248.6270.0211131.5707
RARI
show
1A2OA
CHEB METHYLESTERASE
13815832128.4110.09599511.485
HKPMAAPTTLKAGPLLSSEKL
show
1A8DA
TETANUS NEUROTOXIN
2292351714.1530.00873883.0859
FCKALNP
show
1A8LA
PROTEIN DISULFIDE OXIDOREDUCTASE
1161231817.1120.0533694.8687
REETNLMD
show
1A8LA
PROTEIN DISULFIDE OXIDOREDUCTASE
1291362810.9720.044523.9495
IRNIDQDV
show
1A9XB
CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
163416401710.8830.0367254.5657
AGDNPDA
show
1A9XB
CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
1649165921121.5070.0319314.9899
AFPGLNGMDLA
show
1A9XB
CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
166216683714.5840.0375752.9697
VTTAEAY
show
1A9XB
CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
167016874189.1310.0880629.803
WTQGSWTLTGGLPQAKKE
show
1A9XB
CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
16891692549.2530.0159271.904
ELPF
show
1ADJA
HISTIDYL-TRNA SYNTHETASE
31833111435.9790.048228.8687
AEGFGLPEEKGPDL
show
1AF7A
CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
75811711.5840.0408324.6111
ANQNSAE
show
1AF7A
CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
8910221428.0790.0420395.3182
LTTNLTAFFREAHH
show
1AF7A
CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
112117369.5540.0332343.0101
RRHGEY
show
1AMMA
GAMMA B-CRYSTALLIN
808911019.8020.0743914.0707
LIPQHTGTFR
show
1AORA
ALDEHYDE FERREDOXIN OXIDOREDUCTASE
20421411123.9480.0330687.0051
EGSKTVPIADK
show
1AUAA
PHOSPHATIDYLINOSITOL TRANSFER PROTEIN SEC14P
8688135.5050.00513091.2374
YGT
show
1AUAA
PHOSPHATIDYLINOSITOL TRANSFER PROTEIN SEC14P
941002715.7330.0291624.0303
DFHYDEK
show
1AUAA
PHOSPHATIDYLINOSITOL TRANSFER PROTEIN SEC14P
1061103512.5060.00383191.7121
FYPQY
show
1AW7A
TOXIC SHOCK SYNDROME TOXIN-1
89931511.1270.030463.6263
TNTEK
show
1AW7A
TOXIC SHOCK SYNDROME TOXIN-1
99102248.8010.0184312.0051
ELPL
show
1AW7A
TOXIC SHOCK SYNDROME TOXIN-1
106109345.2390.0358682.0101
VHGK
show
1AW7A
TOXIC SHOCK SYNDROME TOXIN-1
1101184920.9320.0772545.2929
DSPLKYWPK
show
1AXDA
GLUTATHIONE S-TRANSFERASE I
7880136.280.0208462.4596
NKP
show
1AXDA
GLUTATHIONE S-TRANSFERASE I
83892613.320.0408623.1667
LREGNL
show
1AYRA
ARRESTIN
17918911123.5040.0453836.2677
HAPRDMGPQPR
show
1AYRA
ARRESTIN
195203296.6240.0258844.4596
QFFMSDKPL
show
1B12A
SIGNAL PEPTIDASE I
149154167.8020.0127064
GLPGDK
show
1B12A
SIGNAL PEPTIDASE I
158163265.4680.0271074.3737
DPVSKE
show
1B12A
SIGNAL PEPTIDASE I
1671823169.9290.0764088.3333
QPGCSSGQACENALPV
show
1B12A
SIGNAL PEPTIDASE I
1841884511.6010.0337992.6667
YSNVE
show
1B12A
SIGNAL PEPTIDASE I
197199535.560.0279541.7677
SRR
show
1B12A
SIGNAL PEPTIDASE I
2012046410.1340.0192292.6465
GGEA
show
1B12A
SIGNAL PEPTIDASE I
21022071111.3130.0881838.3131
EVPKNETKENG
show
1B12A
SIGNAL PEPTIDASE I
230233845.1270.0182131.7626
LGDV
show
1B12A
SIGNAL PEPTIDASE I
2392479916.20.0475224.1667
TVPIAQDQV
show
1B12A
SIGNAL PEPTIDASE I
249260101213.1090.0450665.5859
MYYQQPGQQLAT
show
1B12A
SIGNAL PEPTIDASE I
26226711610.0280.0175353.0303
IVPPGQ
show
1B63A
MUTL
103107156.1410.00773982.8131
SSVSR
show
1B63A
MUTL
113120284.5770.0371865.0657
RTAEQQEA
show
1B63A
MUTL
126131365.1280.0327633.9242
EGRDMN
show
1B63A
MUTL
1371424612.690.0165852.5505
AAHPVG
show
1B63A
MUTL
1481555814.9550.0203683.2525
LDLFYNTP
show
1B63A
MUTL
1591646613.0540.0424813.1667
KFLRTE
show
1B63A
MUTL
1811867611.5960.0108822.4192
ARFDVT
show
1B63A
MUTL
191194845.260.0191462.601
HNGK
show
1B63A
MUTL
19920991112.5770.0500476.798
YRAVPEGGQKE
show
1B8TA
PROTEIN (CRP1)
66116151157.8190.3749831.379
YGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSD
show
1BCMB
BACTERIOPHAGE MU TRANSPOSASE
472477169.5150.0343371.7778
YARTIV
show
1BCMB
BACTERIOPHAGE MU TRANSPOSASE
4784822512.3820.0229893.6869
RKPTE
show
1BGVA
GLUTAMATE DEHYDROGENASE
1841891611.1340.0214252.3283
VGGFYN
show
1BGVA
GLUTAMATE DEHYDROGENASE
1911972714.6510.00976353.3333
VLTGKAR
show
1BKBA
TRANSLATION INITIATION FACTOR 5A
5460176.4770.0402143.9444
GVFDGGK
show
1BKBA
TRANSLATION INITIATION FACTOR 5A
6670258.7580.0411662.7727
PVDAQ
show
1BKBA
TRANSLATION INITIATION FACTOR 5A
73773512.7420.0295062.0606
VPIIE
show
1C1KA
BPT4 GENE 59 HELICASE ASSEMBLY PROTEIN
107109135.8210.0245431.7879
KQI
show
1C2AA
BOWMAN-BIRK TRYPSIN INHIBITOR
567211731.8310.104738.3081
VGDPGPICRPWECCDKA
show
1C7SA
BETA-N-ACETYLHEXOSAMINIDASE
20121011023.5790.0190015.2677
SNADLQTLPA
show
1C7SA
BETA-N-ACETYLHEXOSAMINIDASE
21322321116.1470.0126675.4242
LRGKIVPTPMQ
show
1C7SA
BETA-N-ACETYLHEXOSAMINIDASE
804806336.7260.00292812.1566
QRE
show
1C7SA
BETA-N-ACETYLHEXOSAMINIDASE
81282341225.9590.00639725.8737
KGGVAYRLPVPG
show
1C8UA
ACYL-COA THIOESTERASE II
1091171918.8840.0403435.0606
QAPEAGFEH
show
1C8UA
ACYL-COA THIOESTERASE II
11813321629.7710.07594910.141
QKTMPSAPAPDGLPSE
show
1C8UA
ACYL-COA THIOESTERASE II
1401463713.1620.0570852.5707
LAHLLPP
show
1C8UA
ACYL-COA THIOESTERASE II
14915841020.8230.0669665.2525
KDKFICDRPL
show
1C8UA
ACYL-COA THIOESTERASE II
16217751611.7070.0859138.0707
PVEFHNPLKGHVAEPH
show
1C96A
MITOCHONDRIAL ACONITASE
47751714141.1690.09823124.652
TLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTY
show
1C96A
MITOCHONDRIAL ACONITASE
51855223548.4210.102720.152
QHPPKDSSGQRVAVSPTSQRLQLLEPFDKWDGKDL
show
1CCZA
PROTEIN (CD58)
931001820.390.0428334.1869
LEMVSKPM
show
1CFBA
DROSOPHILA NEUROGLIAN
70872111432.6150.0654617.9141
TQPDVPFKNPDNVV
show
1CHMA
CREATINE AMIDINOHYDROLASE
1561611612.8770.0133913.0051
RMIKSA
show
1CIIA
COLICIN IA
34635911421.5470.0323257.2071
NILNDRNPVVTEDV
show
1CJXB
4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
14315611421.0650.0696856.9444
YLEGVERNPVGAGL
show
1CQXA
FLAVOHEMOPROTEIN
14515511111.8940.034316.2172
AEQPGGWKGWR
show
1CR5A
SEC18P (RESIDUES 22 - 210)
108113169.7570.0379123.8737
SGKQSY
show
1CR5A
SEC18P (RESIDUES 22 - 210)
12313621413.430.0812096.5707
FRARGKAVSTVFDQ
show
1CS6A
AXONIN-1
2042111817.6940.0325584.3232
AAEDARQY
show
1CS6A
AXONIN-1
2172222615.1790.014893.4242
AKFPAD
show
1CS6A
AXONIN-1
226231369.2650.0147952.3182
LTGQMV
show
1CS6A
AXONIN-1
234236436.850.000766061.0253
ECF
show
1CS6A
AXONIN-1
2402445510.6060.0123053
NPVPQ
show
1CS6A
AXONIN-1
24926461613.7870.0625789.6414
KLDGSQTSKWLSSEPL
show
1CS6A
AXONIN-1
2672727612.1720.020542.5354
IQNVDF
show
1CS6A
AXONIN-1
274276836.2870.00646372.4293
DEG
show
1CS6A
AXONIN-1
284287945.6570.0139332.4848
NIKG
show
1CTTA
CYTIDINE DEAMINASE
148155186.8820.0395633.8838
HLPGREAH
show
1CTTA
CYTIDINE DEAMINASE
1601672817.1510.0375473.6768
YLPDAFGP
show
1CTTA
CYTIDINE DEAMINASE
17019032136.5460.1264210.449
LEIKTLLMDEQDHGYALTGDA
show
1CU1A
PROTEIN (PROTEASE/HELICASE NS3)
18019811924.1990.06158110.48
RSPVFTDNSSPPAVPQSFQ
show
1CU1A
PROTEIN (PROTEASE/HELICASE NS3)
32233621520.2790.0267297.4495
TATPPGSVTVPHPNI
show
1CU1A
PROTEIN (PROTEASE/HELICASE NS3)
3403473814.8510.015864.1919
ALSNTGEI
show
1CU1A
PROTEIN (PROTEASE/HELICASE NS3)
349352444.8240.0042551.8232
FYGK
show
1CVRA
GINGIPAIN R
3453521815.3690.0143452.7828
LVRTLVPT
show
1CWVA
INVASIN
5946001718.7730.0183643.1717
VKGTIAA
show
1CWVA
INVASIN
602604236.9490.00738842.1869
KST
show
1CWVA
INVASIN
69270331219.3870.0277177.1162
TADPIPDAGRSS
show
1CWVA
INVASIN
7937984615.5060.0123432.2828
FPVPTL
show
1CWVA
INVASIN
803806545.0290.0101222.1768
VNGQ
show
1CWVA
INVASIN
80881761014.690.0191335.6566
FATDKGFPKT
show
1CWVA
INVASIN
819823759.1530.00841342.6566
FKNAT
show
1CWVA
INVASIN
828832855.9950.0118732.7626
MDNDV
show
1CWVA
INVASIN
842848976.4850.014353.5556
SSFTPNV
show
1CWVA
INVASIN
8508551065.3050.0153323.6768
VNDQGQ
show
1CWVA
INVASIN
85886611911.2740.0239163.7929
ITYQTYSEV
show
1CWVA
INVASIN
8728791285.6460.0234895.0657
SKKFPSYS
show
1CWVA
INVASIN
88488813512.1850.00926762.1667
FYPNR
show
1CX8A
TRANSFERRIN RECEPTOR PROTEIN
1931991711.530.0162875.0657
KDSAQNS
show
1CX8A
TRANSFERRIN RECEPTOR PROTEIN
377379236.1930.00171221.5808
VSN
show
1CX8A
TRANSFERRIN RECEPTOR PROTEIN
60361331121.9930.0177076.0707
HDVELNLDYEE
show
1CX8A
TRANSFERRIN RECEPTOR PROTEIN
626629444.8430.0136142.0505
NQYR
show
1CX8A
TRANSFERRIN RECEPTOR PROTEIN
6346405715.0010.0157443.5455
EMGLSLQ
show
1CZ4A
VCP-LIKE ATPASE
90971819.6090.0532944.6111
VRTEIAKK
show
1CZ4A
VCP-LIKE ATPASE
10311621415.0930.105737.3535
IIRKDQRLKFGEGI
show
1D2EA
ELONGATION FACTOR TU (EF-TU)
24625911428.3980.0410576.7273
YIPVPTRDLEKPFL
show
1D2OA
COLLAGEN ADHESIN
622626158.640.0151942.9293
YTPGE
show
1D3UB
TRANSCRIPTION INITIATION FACTOR IIB
119612011612.6810.0264242.9697
NLNLTP
show
1D3UB
TRANSCRIPTION INITIATION FACTOR IIB
120412082512.7120.027862.0808
LFVKP
show
1D3YB
DNA TOPOISOMERASE VI A SUBUNIT
1401471818.1490.0153225.6717
IPEEDGSS
show
1D3YB
DNA TOPOISOMERASE VI A SUBUNIT
149153259.8220.0100222.6667
VGPLK
show
1D3YB
DNA TOPOISOMERASE VI A SUBUNIT
158161345.1140.0318042.803
TPEG
show
1D3YB
DNA TOPOISOMERASE VI A SUBUNIT
1661744910.1010.0239364.6212
DCTKLGTGA
show
1D3YB
DNA TOPOISOMERASE VI A SUBUNIT
17618551015.080.0202095.6212
NIPNDVTKLN
show
1D3YB
DNA TOPOISOMERASE VI A SUBUNIT
1871926613.2460.0338743.5455
ETDADF
show
1D5AA
PROTEIN (DNA POLYMERASE)
337341159.6580.000106732.3232
VGQSL
show
1D5AA
PROTEIN (DNA POLYMERASE)
344349269.2350.00456263.2828
VSRSST
show
1D5AA
PROTEIN (DNA POLYMERASE)
36337431229.8090.0191048.5606
ERNDVAPNKPDE
show
1D5YA
ROB TRANSCRIPTION FACTOR
105109159.8920.0208082.9343
RSPEW
show
1D5YA
ROB TRANSCRIPTION FACTOR
11012821917.5080.0795779.0556
SAFGIRPPLRLGEFTMPEH
show
1DKQA
PHYTASE
11312311114.5520.0366446.8687
HTQTDTSSPDP
show
1DKQA
PHYTASE
12513721320.4920.0365296.3131
FNPLKTGVCQLDN
show
1DKQA
PHYTASE
147152369.5720.0141073.0455
RAGGSI
show
1DKQA
PHYTASE
157160445.4270.0177772.0707
GHRQ
show
1DKQA
PHYTASE
170172534.950.00326870.93939
LNF
show
1DKQA
PHYTASE
174176636.6810.011012.1162
QSN
show
1DKQA
PHYTASE
17919071212.7360.0630817.702
LKREKQDESCSL
show
1DKQA
PHYTASE
1931988616.1480.0174333.1263
ALPSEL
show
1DKQA
PHYTASE
200205964.3990.0155982.9495
VSADNV
show
1DKQA
PHYTASE
2072101048.440.00407161.6717
LTGA
show
1DLJA
UDP-GLUCOSE DEHYDROGENASE
3023111108.4120.044526.4697
LKEQESPVKV
show
1DR9A
T LYMPHOCYTE ACTIVATION ANTIGEN
1051121820.6290.0369064.9394
KADFPTPS
show
1DR9A
T LYMPHOCYTE ACTIVATION ANTIGEN
117123276.3390.0504443.8384
EIPTSNI
show
1E0CA
SULFURTRANSFERASE
12214812733.7590.1901115.045
AEDRPLSRELPAPAGGPVALSLHDEPT
show
1E5RA
PROLINE OXIDASE
1761831811.3980.0446464.5051
AFDGPFDE
show
1E7LA
RECOMBINATION ENDONUCLEASE VII
961041917.6740.0739685.3838
KSDYTQNNI
show
1E88A
FIBRONECTIN
404911021.4870.0583114.9899
ETAVTQTYGG
show
1E88A
FIBRONECTIN
9610621127.8280.0607863.6364
FCTDHTVLVQT
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
100104159.7950.00923682.1061
FYHEP
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
106109247.4740.0145872.2374
DNLR
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
114119366.0360.00272563.9495
TGTNGK
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
132137469.4520.0145372.7475
LLGEIS
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
140145567.9950.0028772.8586
MGTVGN
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
3203256610.2650.00984252.2172
ALGYPL
show
1E8CB
UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
33434371018.4970.0164044.601
RLQPVCGRME
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
412416158.3420.00682032.3586
TLKPW
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
4204282917.580.0126794.6515
VQNTTHLDE
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
43544531126.6720.0174447.5101
LKGEPSDMDKA
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
73875141410.9240.00662355.4343
HFPAMVSRISGIGL
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
76679252734.2670.03355513.232
YNEEVVALPVGGFYRFRKSGDRHGWEG
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
1170118461526.0990.00673287.9697
QVSRGAEHLDDLDLN
show
1EA0A
GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN
1187121272640.1250.01820913.626
LAQVDPGENARYCTLQGRNEVPDTLD
show
1EBFA
HOMOSERINE DEHYDROGENASE
145153198.8190.0016443.4141
TVGAGLPII
show
1EBPA
EPO RECEPTOR
117119136.0590.010871.2323
EVV
show
1EBPA
EPO RECEPTOR
1201252615.4630.017782.4141
LLDAPV
show
1EE8A
MUTM (FPG) PROTEIN
961031811.3230.0398024.0657
HDPRRFGR
show
1EE8A
MUTM (FPG) PROTEIN
10811721016.4930.0628145.1364
RRGDYREIPL
show
1EE8A
MUTM (FPG) PROTEIN
20322532312.0490.08812813.101
ELGGSTLSDQSYRQPDGLPGGFQ
show
1EE8A
MUTM (FPG) PROTEIN
22723741113.6610.0525875.0808
RHAVYGREGLP
show
1EFPA
PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
16417511228.8070.0693936.5909
TETAAAADPGLS
show
1EFPA
PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
18219521423.0180.0890798.0606
VAESDRPELTSARR
show
1EFUB
ELONGATION FACTOR TS
51581814.5570.0257924.5455
KAGNVAAD
show
1EFUB
ELONGATION FACTOR TS
1011072714.4090.0357793.596
AGKITDV
show
1EFUB
ELONGATION FACTOR TS
1251303612.5980.0066843.2879
IGENIN
show
1EG4A
DYSTROPHIN
981041710.2840.047723.0455
LNNVRFS
show
1EG4A
DYSTROPHIN
118121247.9220.00450190.72727
ALCL
show
1EG4A
DYSTROPHIN
1231263410.0080.00843091.1869
LLSL
show
1EG4A
DYSTROPHIN
13514441016.6030.0730956.4192
QHNLKQNDQP
show
1EG4A
DYSTROPHIN
1641715812.3140.0546783.803
EHNNLVNV
show
1EG4A
DYSTROPHIN
186193688.5290.0266844.2273
YDTGRTGR
show
1EG4A
DYSTROPHIN
205211778.7340.0257022.6768
SLCKAHL
show
1EI1A
DNA GYRASE B
8289183.9120.0339924.4949
IHPEEGVS
show
1EI1A
DNA GYRASE B
96100258.7220.00653931.399
TVLHA
show
1EI1A
DNA GYRASE B
1011193199.370.03651710.51
GGKFDDNSYKVSGGLHGVG
show
1EI1A
DNA GYRASE B
125127435.58201.2778
ALS
show
1EI1A
DNA GYRASE B
136139545.470.015413.1263
REGK
show
1EI1A
DNA GYRASE B
146149645.3230.0165751.9697
EHGV
show
1EI1A
DNA GYRASE B
1501557611.1110.0234383.101
PQAPLA
show
1EI1A
DNA GYRASE B
1591648612.9560.0351574.5
ETEKTG
show
1EI1A
DNA GYRASE B
17118491416.1040.0528976.9949
PSLETFTNVTEFEY
show
1EI1A
DNA GYRASE B
19720210611.6410.0113953.197
LDSGVS
show
1EI1A
DNA GYRASE B
2072131175.9630.0370995.7828
DKRDGKE
show
1EI1A
DNA GYRASE B
21622112612.080.0264162.6566
FHYEGG
show
1EI5A
D-AMINOPEPTIDASE
33034411539.8670.0528098.4697
LGVSSSEVSRVEADS
show
1EPFB
PROTEIN (NEURAL CELL ADHESION MOLECULE)
961001511.4850.0203572.1263
FQKLM
show
1EPFB
PROTEIN (NEURAL CELL ADHESION MOLECULE)
1031082611.6840.0274333.7374
NAPTPQ
show
1EPFB
PROTEIN (NEURAL CELL ADHESION MOLECULE)
109116388.750.0596165.8081
EFKEGEDA
show
1EU3A
SUPERANTIGEN SMEZ-2
931011917.5210.0739345.5657
PYQKTSIPK
show
1EXNB
5'-EXONUCLEASE
184189169.6160.0155142.8889
HNVDDV
show
1F00I
INTIMIN
730732136.5410.00313961.0101
SLV
show
1F00I
INTIMIN
736743289.0550.0369783.3232
VSDVAVDV
show
1F00I
INTIMIN
7447483511.4420.0199543.2323
KAPEV
show
1F00I
INTIMIN
7517554511.5860.0163961.6212
FTTLT
show
1F0XA
D-LACTATE DEHYDROGENASE
1891991119.8090.0254755.6616
NHLGIDLGETP
show
1F0XA
D-LACTATE DEHYDROGENASE
2072132716.0160.0164124.9545
DDDRIKD
show
1F0XA
D-LACTATE DEHYDROGENASE
21622831325.8620.0374295.6667
VRHDGRHAHDYDY
show
1F0XA
D-LACTATE DEHYDROGENASE
23324741519.7120.0298358.6111
RDIEADTPARYNADP
show
1F0XA
D-LACTATE DEHYDROGENASE
24926151317.950.00852446.3889
RLFESSGCAGKLA
show
1F0XA
D-LACTATE DEHYDROGENASE
268270636.6890.00240051.3535
DTF
show
1F0XA
D-LACTATE DEHYDROGENASE
2712777717.0210.0324815.3939
EAEKNQQ
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
165168145.2310.00679311.9697
TPYG
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
1711762614.9710.0118883.697
RTSRNP
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
178180336.0890.000495331.7677
TDT
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
18319841617.650.0221487.6364
LFNPWCEDDAVYLDNE
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
2042095610.2650.00254742.0909
YVLNDI
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
216219645.3490.00527172.6515
EVND
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
2262347912.1960.0052014.7576
SYGQFEDGI
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
2442498612.220.00838522.8283
RAQMDL
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
251255958.5030.00300743.2677
GRGNP
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
2672751095.2240.0168775.6818
NAKDDEGVL
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
277296112017.7350.0211589.0152
GSWDNIYAYGVPPSAWTGSV
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
3053091258.5490.00912823.2727
SENPV
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
4024051345.4920.00166292.9141
NSDG
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
419428141011.170.00661623.2677
HGHVCFQFDA
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
4364381536.8530.0017692.2727
NSD
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
4444501674.7770.0160634.5758
AKKDGTH
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
45646317815.470.00859753.8485
DATHIGKL
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
4674741884.7580.0149664.7828
KQIGGDGM
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
4764781935.7260.00385651.4141
DIT
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
48148820815.2270.0215115.0859
YKFQEGQE
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
499518212035.3150.0450411.303
MYGAKKPLNTEGVMKSRSNV
show
1F13A
CELLULAR COAGULATION FACTOR XIII ZYMOGEN
62663322820.8430.0129142.803
VLTIPEII
show
1F4AA
BETA-GALACTOSIDASE
217221156.8220.00452493.3434
KPTTQ
show
1F4AA
BETA-GALACTOSIDASE
3323352410.1560.00239551.6768
FREV
show
1F4AA
BETA-GALACTOSIDASE
338341345.1490.00733452.4848
ENGL
show
1F4AA
BETA-GALACTOSIDASE
344347445.3540.00313492.5253
LNGK
show
1F4AA
BETA-GALACTOSIDASE
348351549.4840.002781.1616
PLLI
show
1F4AA
BETA-GALACTOSIDASE
632635645.1740.00703872.5
SGQT
show
1F4AA
BETA-GALACTOSIDASE
64065171213.210.0122736.1616
SEYLFRHSDNEL
show
1F4AA
BETA-GALACTOSIDASE
658661844.8510.00464322.6263
LDGK
show
1F4AA
BETA-GALACTOSIDASE
6696779913.3650.0160885.303
PLDVAPQGK
show
1F4AA
BETA-GALACTOSIDASE
681692101223.9560.0272087.8232
ELPELPQPESAG
show
1F4AA
BETA-GALACTOSIDASE
70271311125.1240.0197566.3636
QPNATAWSEAGH
show
1F4AA
BETA-GALACTOSIDASE
725739121535.4820.0339226.3384
NLSVTLPAASHAIPH
show
1F4AA
BETA-GALACTOSIDASE
7427461356.2790.0121853.2172
TSEMD
show
1FBVA
SIGNAL TRANSDUCTION PROTEIN CBL
34036512621.7910.1146914.869
PDGRNQNPDLTGLCEPTPQDHIKVTQ
show
1FBVA
SIGNAL TRANSDUCTION PROTEIN CBL
3723802911.9580.0154343.9242
CEMGSTFQL
show
1FCFA
PHOTOSYSTEM II D1 PROTEASE
144148155.9620.0171743.0909
LEPSR
show
1FCFA
PHOTOSYSTEM II D1 PROTEASE
15116121115.7470.0489955.0909
ALRRGTAGSVT
show
1FCFA
PHOTOSYSTEM II D1 PROTEASE
2482553820.5980.0303633.9899
QKVTINPV
show
1FCFA
PHOTOSYSTEM II D1 PROTEASE
2602654612.6760.0165562.399
CSNVAA
show
1FCFA
PHOTOSYSTEM II D1 PROTEASE
2672775118.6230.0335625.9747
ALPPGAAKQQL
show
1FJEB
NUCLEOLIN RBD12
869711219.3320.103219.0657
EKPKGRDSKKVR
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
27729311728.4490.0247468.4646
RAKGSTKFTRVPKRVYW
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
295303299.9560.0133094.4545
MLATNLTDK
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
3193233510.6950.0115562.9192
KAGSL
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
3353414715.9390.0108392.8939
LGFDEVI
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
353358569.7940.00231122.1263
NTGIFI
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
361364645.2850.0154212.2222
KGRF
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
36738271623.1060.0408856.702
LKDHILQFVIPNRGVT
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
3843898615.7740.0224753.6414
QLVKSE
show
1FOKA
PROTEIN (FOKI RESTRICTION ENDONUCLEAS)
400406979.9810.0212793.3838
KLKYVPH
show
1FPOA
CHAPERONE PROTEIN HSCB
6264136.2630.016581.4899
RHP
show
1FPOA
CHAPERONE PROTEIN HSCB
738921723.1850.086318.202
SLHGFDLASEQHTVRDT
show
1FXLA
PARANEOPLASTIC ENCEPHALOMYELITIS ANTIGEN HUD
1141201716.9530.0500343.6263
YARPSSA
show
1FXLA
PARANEOPLASTIC ENCEPHALOMYELITIS ANTIGEN HUD
122126259.4890.0320262.601
IRDAN
show
1FXXA
EXONUCLEASE I
200202136.2510.00901261.9293
RQP
show
1FXXA
EXONUCLEASE I
2102142510.2340.0118262.9545
THRNK
show
1G0YR
INTERLEUKIN-1 RECEPTOR, TYPE I
971071119.2480.04835.6667
VENEPNLCYNA
show
1G0YR
INTERLEUKIN-1 RECEPTOR, TYPE I
109111236.410.00183580.57576
AIF
show
1G0YR
INTERLEUKIN-1 RECEPTOR, TYPE I
19821031318.3340.0604557.0404
FITLEENKPTRPV
show
1G0YR
INTERLEUKIN-1 RECEPTOR, TYPE I
2112174713.0740.0114583.7929
IVSPANE
show
1G1TA
E-SELECTIN
1191261814.3790.0602973.6717
TAACTNTS
show
1G38A
MODIFICATION METHYLASE TAQI
165167135.5030.00180591.6061
PAT
show
1G38A
MODIFICATION METHYLASE TAQI
169172249.1920.00610821.4091
LVLE
show
1G38A
MODIFICATION METHYLASE TAQI
184186337.3010.00685192.601
EGK
show
1G38A
MODIFICATION METHYLASE TAQI
1932034114.7990.0411646.4545
GEVFPQKKVSA
show
1G38A
MODIFICATION METHYLASE TAQI
2092155710.7230.0172624.8283
QKSGKGL
show
1G38A
MODIFICATION METHYLASE TAQI
223226644.9430.0205023.0354
SESG
show
1G38A
MODIFICATION METHYLASE TAQI
23524871415.1160.0384556.8535
YPHWEGEIIRFETE
show
1G38A
MODIFICATION METHYLASE TAQI
254258857.8310.0167842.6768
EISGM
show
1G38A
MODIFICATION METHYLASE TAQI
2682729512.0560.0100392.1061
FAARS
show
1G38A
MODIFICATION METHYLASE TAQI
277289101316.3390.056947.8939
KHPAVRKEPGPGL
show
1G71A
DNA PRIMASE
2142191610.90.0113431.798
ILRVNV
show
1G71A
DNA PRIMASE
223229276.7560.039992.798
LSIGIRR
show
1G71A
DNA PRIMASE
237239335.8170.0151882.0606
DHK
show
1G71A
DNA PRIMASE
24526141717.0440.059287.4394
GFVRKAILASFPEGVGI
show
1G7TA
TRANSLATION INITIATION FACTOR IF2/EIF5B
219222149.5080.0119711.7677
YLRE
show
1G7TA
TRANSLATION INITIATION FACTOR IF2/EIF5B
2262312610.8840.0138874.3131
IEEDSP
show
1G8KA
ARSENITE OXIDASE
67468511229.3780.0219985.8182
HFKPAPWNGLPA
show
1GM5A
RECG
24425511214.3390.0167366.3485
TPKEGEYVRRIL
show
1GM5A
RECG
2572662106.6150.012624.2576
IYRLTSGISQ
show
1GM5A
RECG
2822903917.2460.0164385.1616
CSLKETLPE
show
1GM5A
RECG
2963024717.2090.00813233.6162
RKLLGVK
show
1GM5A
RECG
3093145611.3010.00277692.5455
HFPKTF
show
1GM5A
RECG
34635661131.0740.0199347.0808
HGGIPKKIEGK
show
1GM5A
RECG
3643717817.4820.0168844.0152
SLPFKLTN
show
1GM5A
RECG
3853938916.2790.0103895.1768
ISEKPMNRL
show
1GM5A
RECG
5235299714.0650.00699183.697
SATPIPR
show
1GM5A
RECG
53554210813.0130.00971913.2424
FYGDLDVT
show
1GM5A
RECG
544555111224.2210.0202817.5455
IDEMPPGRKEVQ
show
1GM5A
RECG
55656412915.1870.0136863.4697
TMLVPMDRV
show
1GNTA
HYBRID CLUSTER PROTEIN
687711011.0240.00642454.9747
ATITNANWDD
show
1GNTA
HYBRID CLUSTER PROTEIN
10611621123.4330.0436017.5101
NGKDFSEPLPE
show
1GNTA
HYBRID CLUSTER PROTEIN
1181243717.390.0178093.5303
ATWTGDS
show
1GNTA
HYBRID CLUSTER PROTEIN
1311364610.6360.0113373.0152
AKSVGI
show
1GNTA
HYBRID CLUSTER PROTEIN
1381425510.520.0213053.5202
ATENE
show
1GOFA
GALACTOSE OXIDASE
131139199.2020.0145825.3232
EANGQPWTS
show
1GOFA
GALACTOSE OXIDASE
140142235.60.000738311.4798
IAE
show
1GOFA
GALACTOSE OXIDASE
14716031419.6360.0464217.6111
QASSYTAPQPGLGR
show
1GOFA
GALACTOSE OXIDASE
1661734815.880.000369163.5101
DLPIVPAA
show
1GOFA
GALACTOSE OXIDASE
176183584.5810.00913664.298
IEPTSGRV
show
1GOFA
GALACTOSE OXIDASE
1862026176.9650.0260728.702
WSSYRNDAFGGSPGGIT
show
1GOFA
GALACTOSE OXIDASE
207214784.4770.0161043.6414
WDPSTGIV
show
1GOFA
GALACTOSE OXIDASE
21923081217.3730.0144434.9545
VTVTKHDMFCPG
show
1GOFA
GALACTOSE OXIDASE
233239974.1710.00530663.8687
MDGNGQI
show
1GOFA
GALACTOSE OXIDASE
32032810911.0520.022384.5707
MLTADKQGL
show
1GOFA
GALACTOSE OXIDASE
33133711714.5430.00143053.0657
SDNHAWL
show
1GOFA
GALACTOSE OXIDASE
3393411237.1280.00207651.6414
GWK
show
1GOFA
GALACTOSE OXIDASE
3433451336.8010.000276871.4949
GSV
show
1GOFA
GALACTOSE OXIDASE
3473531478.6910.00258414.0404
QAGPSTA
show
1GOFA
GALACTOSE OXIDASE
3583641574.960.017954.1414
YTSGSGD
show
1GOFA
GALACTOSE OXIDASE
3703721635.8080.00922892.197
KRQ
show
1GOFA
GALACTOSE OXIDASE
3733761745.5080.0161512.6111
SNRG
show
1GOFA
GALACTOSE OXIDASE
37738518917.3750.00853684.1263
VAPDAMCGN
show
1GOFA
GALACTOSE OXIDASE
3903951965.1460.0133364.0101
DAVKGK
show
1GOFA
GALACTOSE OXIDASE
39941420164.1680.0200279.2626
FGGSPDYQDSDATTNA
show
1GOFA
GALACTOSE OXIDASE
41842721105.3760.0210426.2475
TLGEPGTSPN
show
1GOFA
GALACTOSE OXIDASE
430443221419.6460.0187815.0404
FASNGLYFARTFHT
show
1GOFA
GALACTOSE OXIDASE
4464522374.4350.00299943.6818
VLPDGST
show
1GOFA
GALACTOSE OXIDASE
45547424206.6250.03363911.081
TGGQRRGIPFEDSTPVFTPE
show
1GOFA
GALACTOSE OXIDASE
4804822535.2240.00996721.9697
QDT
show
1GOFA
GALACTOSE OXIDASE
485497261319.890.0121826.5657
KQNPNSIVRVYHS
show
1GOFA
GALACTOSE OXIDASE
5015072774.7260.00567583.1768
LLPDGRV
show
1GOFA
GALACTOSE OXIDASE
51152428146.0840.0179966.3535
GGGLCGDCTTNHFD
show
1GOFA
GALACTOSE OXIDASE
5295312936.5310.00369161.9293
TPN
show
1GOFA
GALACTOSE OXIDASE
5345403074.1630.0290253.8232
YNSNGNL
show
1GPLA
RP2 LIPASE
3273381129.2610.0263375.7222
LNTGASDNFTRW
show
1GQIA
ALPHA-GLUCURONIDASE
13614511017.5730.0257545.4394
QTQHALEKLS
show
1GQIA
ALPHA-GLUCURONIDASE
1481542716.2380.0101253.4394
SAPRLQH
show
1GQIA
ALPHA-GLUCURONIDASE
15817932217.8780.0113029.3535
NHWDNLNRVVERGYAGLSLWDW
show
1GQIA
ALPHA-GLUCURONIDASE
1811884812.9950.0130663.7525
SLPNYLAP
show
1GQIA
ALPHA-GLUCURONIDASE
198204579.320.00147053.404
ASLGING
show
1GQIA
ALPHA-GLUCURONIDASE
2062146914.5110.00235274.5354
VINNVNADP
show
1GQIA
ALPHA-GLUCURONIDASE
217219736.6070.0030251.702
LSD
show
1GQIA
ALPHA-GLUCURONIDASE
235238848.9430.00588191.8838
YGIK
show
1GQIA
ALPHA-GLUCURONIDASE
243247957.7860.00235272.3434
INFNS
show
1GQIA
ALPHA-GLUCURONIDASE
250262101317.2740.0241167.0455
AFGDVDTADPLDP
show
1GQIA
ALPHA-GLUCURONIDASE
27828411713.0670.00894883.1414
YIPDFGG
show
1GQIA
ALPHA-GLUCURONIDASE
287297121111.2770.0108817.4646
VKADSEGQPGP
show
1GQIA
ALPHA-GLUCURONIDASE
30030413510.9060.0100832.3535
YGRDH
show
1GQIA
ALPHA-GLUCURONIDASE
3183211449.1780.00604991.4747
FGGV
show
1GQIA
ALPHA-GLUCURONIDASE
325336151216.2840.0228975.4697
RAFVYHPDIEDR
show
1GQIA
ALPHA-GLUCURONIDASE
34735516912.2990.0141584.7778
LDGKFADNV
show
1GQIA
ALPHA-GLUCURONIDASE
36037517169.7550.00537779.0556
KNGPIDFQPREPFSAL
show
1GQIA
ALPHA-GLUCURONIDASE
37838318611.7050.0109653.3232
GMSRTN
show
1GQIA
ALPHA-GLUCURONIDASE
389405191710.8220.0032776.8737
QITQEYFGFATHLAYQG
show
1GQIA
ALPHA-GLUCURONIDASE
41242420136.6160.0291157.6465
LKTETHARGEGST
show
1GQIA
ALPHA-GLUCURONIDASE
43044021117.6290.0297456.1313
EGKVFKTRHTG
show
1GQIA
ALPHA-GLUCURONIDASE
444459221611.7340.00710027.1717
VINPGTDRNWTGHPFV
show
1GQYB
UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
3053101611.5190.0118423.8081
EEGIAN
show
1GQYB
UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
31832821116.1450.0171945.5808
ADFQGAGRRFD
show
1GSAA
GLUTATHIONE SYNTHETASE
121126169.280.0134013.6818
DCNEKL
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
1221291820.630.0402874.0354
VPQIRAPS
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
1361402511.7580.0027242.5101
IGGGT
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
1521573611.9370.019023.6566
RDPGAR
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
16217241119.4040.0216976.7121
SEDPELPYMRP
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
175177537.0620.00119472.6768
SKE
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
179186689.5140.0239434.0253
WFSDDPNV
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
189191735.280.00621271.298
TLQ
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
193199874.6870.0197374.5253
RQWNGKE
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2012079712.1240.0158663.1515
SIYFQPP
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
20921310513.1070.00888891.4394
FYVSA
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2182231169.9410.0236083.8131
NIENGG
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
22823212510.8880.00955793.2475
TGKKV
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2362411365.2220.0143853.101
DVRGNM
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2442491466.3440.0138593.7424
LNDGSQ
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
25726115511.5340.00301082.2727
IATGG
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
26326716512.6610.0142412.8485
PRSLS
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2702741759.5730.0192592.803
DRAGA
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2772801845.3920.0138112.7121
KSRT
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
28228619511.6140.00912781.8535
LFRKI
show
1GV4A
PROGRAMED CELL DEATH PROTEIN 8
2963012068.0210.0223664.0556
SREVKS
show
1GZ0F
HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
74821924.5470.0553235.4646
VKPGRQYQE
show
1GZ0F
HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
90962712.3430.0351983.5657
ASLDQPF
show
1GZ4A
NAD-DEPENDENT MALIC ENZYME
269275176.8840.0148023.2172
YREKYCT
show
1GZ4A
NAD-DEPENDENT MALIC ENZYME
277282266.9920.00092193.8131
NDDIQG
show
1GZHB
TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
183718431713.930.0393623.4848
ANQLQNY
show
1GZHB
TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
184518512717.2140.00475522.9444
NYLLPAG
show
1GZHB
TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
18531858365.5880.0390983.9899
SLEEQR
show
1GZHB
TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
1860187341427.0120.0793417.9444
LDWQPRENPFQNLK
show
1H03P
COMPLEMENT DECAY-ACCELERATING FACTOR
6668136.3370.0188431.202
EIY
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
2542601712.9060.0182184.2576
EKELYFK
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
2732792712.7210.0111492.8939
VGEGFAF
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
280283345.3740.00896442.7172
EEGL
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
284287446.6240.00330941.2273
FAGY
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
288293565.5780.0203714.6818
NKETRK
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
294296635.580.00475531.9545
YDK
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
29932072212.150.04299113.237
WGFERDENGNPKRDETLKHPRC
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
43043981012.520.00999264.6061
GTARASIPTY
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
44645891312.1610.0214957.1919
FTPVSKDPQSANW
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
47347910710.7590.00828973.1919
MWPDADL
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
485497111323.8090.010257.7576
YLPKGEDGKDYSW
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
50551112712.4540.0117284.1263
FQGKIKG
show
1H0HA
FORMATE DEHYDROGENASE (LARGE SUBUNIT)
796850135540.6910.0767627.182
AYLYGPGREDGPLPEYYEPMECPVIEHPFSKTLHNPTALHFATEEKAVCDPRYPF
show
1H2UA
80 KDA NUCLEAR CAP BINDING PROTEIN
24125211224.9620.0301596.2727
KDRWQERHILRP
show
1H2UA
80 KDA NUCLEAR CAP BINDING PROTEIN
26029423538.0550.07018915.449
LCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDY
show
1H2UA
80 KDA NUCLEAR CAP BINDING PROTEIN
29630931419.7070.0243198.2778
DDPEGPVMPGSHSV
show
1H2UA
80 KDA NUCLEAR CAP BINDING PROTEIN
47649842335.850.04733911.995
LCPSNPTCIYKYGDESSNSLPGH
show
1H4TA
PROLYL-TRNA SYNTHETASE
273278169.3160.0146053.697
HGDDRG
show
1H54B
MALTOSE PHOSPHORYLASE
264271189.3360.0205224.6364
TSRDYDTQ
show
1H54B
MALTOSE PHOSPHORYLASE
285290269.5830.011932.7727
VAQSSY
show
1H54B
MALTOSE PHOSPHORYLASE
308311349.4940.00226321.8182
SDVV
show
1H54B
MALTOSE PHOSPHORYLASE
313316447.1550.0102043.298
KGDD
show
1H54B
MALTOSE PHOSPHORYLASE
69870851115.6390.0191424.8636
YAPFLPKTWTS
show
1H6TA
INTERNALIN B
606911013.5120.0515116.4394
NLKKKSVTDA
show
1H6TA
INTERNALIN B
7072236.7750.00537751.2778
VTQ
show
1H6TA
INTERNALIN B
76803510.9590.0203073.0606
NSIDQ
show
1H6TA
INTERNALIN B
829441313.1530.0460626.9192
IANNSDIKSVQGI
show
1H6TA
INTERNALIN B
961025714.7390.0181843.3485
YLPNVTK
show
1H6TA
INTERNALIN B
10411461116.4170.03465.8788
FLNGNKLTDIK
show
1H6TA
INTERNALIN B
1161247911.9990.0285863.9697
LANLKNLGW
show
1H6TA
INTERNALIN B
12613581013.2940.0391285.8485
FLDENKVKDL
show
1H6TA
INTERNALIN B
1381469912.1340.0338926.0152
LKDLKKLKS
show
1H6TA
INTERNALIN B
148158101115.2590.0287985.9394
SLEHNGISDIN
show
1H6TA
INTERNALIN B
24324711511.6160.031842.7323
LNKPI
show
1H6TA
INTERNALIN B
24825212510.2510.0282323.0758
NHQSN
show
1H6TA
INTERNALIN B
256266131110.2590.0343886.6061
PNTVKNTDGSL
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
249254166.7270.00879113.7626
KDLGVK
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
25726821217.6840.015776.6313
CGKSLSENEITL
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
2732783611.7740.0118214.0909
EEGYKA
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
2812874715.9460.0054373.3636
IGIGLPE
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
2882925512.670.0103333.8586
PKTDD
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
2943036107.8920.0171774.8636
FQGLTQDQGF
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
31733471821.8680.0236418.404
SKAGMCACHSPLPSIRGA
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
3383428511.6420.00338122.6717
LGAGD
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
3533589611.30.00535582.6313
RCGARR
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
36236710610.2850.00676242.4141
VFRKGF
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
36937411611.3610.00835842.6414
NIRAVP
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
38238612510.2020.00405753.8889
EEKCE
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
3883911347.1020.00119021.101
LPFL
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
3994021445.3980.0119832.8081
KGGR
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
4134191574.4190.0175824.5707
QDETGKW
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
4304331649.4330.00586982.3687
KADV
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
43644017510.7190.00335422.5354
SAFGS
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
44144518511.9210.00884522.3788
VLRDP
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
449476192814.6330.04295515.126
EALSPIKFNRWDLPEVDPETMQTSEPWV
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
4784812049.4210.00129842.5152
AGGD
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
48348921713.230.00724933.0909
VGMANTT
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
510527221833.3550.0261038.9394
QYGASVSAKPELPLFYTP
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
53053523615.1070.00811492.0909
LVDISV
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
8408442458.3780.00481482.9495
LKSIE
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
846859251419.850.0183678.0808
LQGWDGQSPGTESH
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
8608632645.3630.00476073.3131
QKGK
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
864880271720.4150.0277268.9596
PVPRIAELMGKKLPNFG
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
899921282355.2140.05785913.066
EQNAAFPPLERKPFIPKKPIPAI
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
92492929610.7690.00603212.4545
VIGKAL
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
9329353049.3420.00397631.3232
LGTF
show
1H7XB
DIHYDROPYRIMIDINE DEHYDROGENASE
93794431816.9050.0122544.4444
ELSNIEQV
show
1H8LA
CARBOXYPEPTIDASE GP180 RESIDUES 503-882
303305136.8670.0106451.399
HRG
show
1H99A
TRANSCRIPTION ANTITERMINATOR LICT
1641701711.880.0439154.7374
ELNEEMP
show
1HF2B
SEPTUM SITE-DETERMINING PROTEIN MINC
961031818.7560.0392314.5303
TVESTGKV
show
1HH2P
N UTILIZATION SUBSTANCE PROTEIN A
12113711725.5430.06300810.97
LEKEKQFEKYSELKGTV
show
1HH2P
N UTILIZATION SUBSTANCE PROTEIN A
197201259.680.00826732.6364
SRRVP
show
1HH2P
N UTILIZATION SUBSTANCE PROTEIN A
211213336.4790.00679971.8081
EIP
show
1HH2P
N UTILIZATION SUBSTANCE PROTEIN A
217220447.2240.00958811.6212
NGIV
show
1HLVA
MAJOR CENTROMERE AUTOANTIGEN B
647511221.8290.0997626.7626
TCRKTNKLSPYD
show
1HP1A
5'-NUCLEOTIDASE
321324149.3370.0151642.6616
KKRV
show
1HP1A
5'-NUCLEOTIDASE
33434321020.6890.0348955.3232
LYTPEIAENQ
show
1HP1A
5'-NUCLEOTIDASE
359363358.7320.0172362.9242
QLEVK
show
1HP1A
5'-NUCLEOTIDASE
367371458.0730.0097012.5202
TNGRL
show
1HTOA
GLUTAMINE SYNTHETASE
9210411311.8480.0412627.096
HDPFTLEPYSRDP
show
1HXMA
GAMMA-DELTA T-CELL RECEPTOR
11812811119.8620.0747697.4899
EPRSQPHTKPS
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
9710611017.4820.0218046.4697
TGGHPSKEAQ
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
1952022817.960.0296094.9646
VDTGAEKR
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
2082133612.1050.0174683.6111
NKRDAY
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
2182224511.610.0021062.8687
VGSGP
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
233238569.7550.0180873.2778
RKGIRT
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
2412476711.650.0106953.7071
MGERFGG
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
2492667185.0240.0487699.2576
VLDTVDIENYISVPKTEG
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
278282856.9190.0176742.6364
SDYDV
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
2852909611.3470.00706143.4545
IDSQSA
show
1HYUA
ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
29430310105.8560.0237864.7778
VPAATEGGLH
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
77831710.4550.0374262.8182
GRHVRGI
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
86922711.2780.0102393.9646
DINNISP
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
1011063610.4770.0254213.5152
LIEKGG
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
112116457.8810.0123581.8535
IMGSV
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
122124536.4080.0129761.4697
DIR
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
128132655.2670.0240973.1162
SGRDA
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
141144749.2320.013771.6515
YGLN
show
1I36A
CONSERVED HYPOTHETICAL PROTEIN MTH1747
1471548810.0530.036724.9899
VRGREPGD
show
1I5PA
PESTICIDIAL CRYSTAL PROTEIN CRY2AA
4694741612.5940.0021363.8232
NRKNNI
show
1I5PA
PESTICIDIAL CRYSTAL PROTEIN CRY2AA
477482265.2780.0125983.9293
ANENGT
show
1I5PA
PESTICIDIAL CRYSTAL PROTEIN CRY2AA
4864933811.4560.0158244.3182
LAPEDYTG
show
1I8TA
UDP-GALACTOPYRANOSE MUTASE
708311427.7370.0302626.9747
NDLVEFNRFTNSPL
show
1I8TA
UDP-GALACTOPYRANOSE MUTASE
8689245.2350.0238082.9545
YKDK
show
1I8TA
UDP-GALACTOPYRANOSE MUTASE
9297369.230.00158312.6414
NLPFNM
show
1I8TA
UDP-GALACTOPYRANOSE MUTASE
1041094612.2230.0152233.3384
WGVKDP
show
1I8TA
UDP-GALACTOPYRANOSE MUTASE
11913151316.640.0645448.9798
QKKKYGDKVPENL
show
1IJHA
CHOLESTEROL OXIDASE
30331811618.420.0384018.4091
DTGTLPNLNSEVGAGW
show
1IJHA
CHOLESTEROL OXIDASE
3193242612.0960.000491623.5859
GPNGNI
show
1IJHA
CHOLESTEROL OXIDASE
32934631818.5520.033438.3283
ANHMWNPTGAHQSSIPAL
show
1IJHA
CHOLESTEROL OXIDASE
350358495.0210.0219045.0758
AWDNSDSSV
show
1IJHA
CHOLESTEROL OXIDASE
36337351110.1710.0185184.8788
APMPAGLETWV
show
1IJHA
CHOLESTEROL OXIDASE
3803886921.5480.0190645.2929
TKNPQRGTF
show
1IJHA
CHOLESTEROL OXIDASE
391396765.360.0242533.4596
DAATDR
show
1IJHA
CHOLESTEROL OXIDASE
3994038511.7640.011581.8788
LNWTR
show
1IO1A
PHASE 1 FLAGELLIN
146154194.2580.0296825.4798
QVGANDGET
show
1IO1A
PHASE 1 FLAGELLIN
15917922145.3460.0443311.273
LKQINSQTLGLDTLNVQQKYK
show
1IO1A
PHASE 1 FLAGELLIN
1841903718.6490.0235342.6515
AATVTGY
show
1IO1A
PHASE 1 FLAGELLIN
287289435.3570.00811681.4545
DLT
show
1IO1A
PHASE 1 FLAGELLIN
2973045813.4650.0270883.5707
AAGVTGTA
show
1IO1A
PHASE 1 FLAGELLIN
312318674.1590.0261754.8636
TDNNGKT
show
1IO1A
PHASE 1 FLAGELLIN
327330745.4020.0133042.4343
VGDD
show
1IO1A
PHASE 1 FLAGELLIN
336342874.1970.0212774.702
QNKDGSI
show
1IO1A
PHASE 1 FLAGELLIN
3443499615.8580.0117192.9091
INTTKY
show
1IO1A
PHASE 1 FLAGELLIN
350360101114.6720.0303546.3889
TADDGTSKTAL
show
1IO1A
PHASE 1 FLAGELLIN
3643701175.1310.00734844.6263
GGADGKT
show
1IO1A
PHASE 1 FLAGELLIN
3753781245.3970.0108062.399
IGGK
show
1IO1A
PHASE 1 FLAGELLIN
385407132324.5020.07285913.217
AEGHNFKAQPDLAEAAATTTENP
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
42143611624.3830.05511.505
EAEDDFKIEKPTKEDA
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
448452255.8380.00696262.702
FGEGA
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
4554603612.1040.0157943.5202
AFDDAK
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
463469474.6580.0196733.9596
LSKTGMP
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
473478564.3170.0210754.0303
KVNGKR
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
482489684.5670.0109353.6768
VRADDGLL
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
491493736.4550.00144860.91414
LGI
show
1IQ8A
ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE
5025098812.5560.0163083.1768
VLPYPRMR
show
1IQCA
DI-HEME PEROXIDASE
16016911015.1540.0626286.2727
LEGDKNALNQ
show
1IQCA
DI-HEME PEROXIDASE
181183235.9380.00639221.3687
SGC
show
1IQPA
RFCS
1651711719.1060.0391613.3485
RFRPLRD
show
1IQPA
RFCS
183188268.0060.0301044.404
ENEGLE
show
1IQPA
RFCS
189191336.6890.0107511.5859
LTE
show
1IQPA
RFCS
201205457.1690.0151823.0758
AEGDM
show
1IQPA
RFCS
216221567.0310.0199393.7929
AALDKK
show
1IQPA
RFCS
222224636.8560.00488691.4141
ITD
show
1IQPA
RFCS
2302367714.5850.00853593.4444
VASRARP
show
1IZ1B
LYSR-TYPE REGULATORY PROTEIN
87911510.2540.020042.7727
RGDVG
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
99102147.5880.0099411.5707
RGWA
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
1051092511.4530.00966862.6212
AFETP
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
1191253710.9850.0173854.404
KGGYDGR
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
128131448.3010.0155242.3081
NIPP
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
1391455713.2270.0300053.7525
RRGEPHV
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
1481556814.9110.0184294.3939
LKVPRPGT
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
160164755.070.0097143.1111
DELRG
show
1J09A
GLUTAMYL-TRNA SYNTHETASE
1721778615.150.0114392.9091
EIPDVV
show
1J1LA
PIRIN
119122149.3580.00917642.1263
NLRS
show
1J1LA
PIRIN
12413027140.0321174.702
EKMVEPQ
show
1J1LA
PIRIN
134136336.4640.01431.8737
LKS
show
1J1LA
PIRIN
1381434615.1860.0253884.2576
EIPKPS
show
1J1LA
PIRIN
144147545.2350.0225592.6061
KDGV
show
1J1LA
PIRIN
153155636.7560.00986462.3182
SGE
show
1J1LA
PIRIN
156159745.5610.0146821.3182
ALGI
show
1J1LA
PIRIN
16016981012.0450.0457295.6465
KSKVYTRTPT
show
1J5YA
TRANSCRIPTIONAL REGULATOR, BIOTIN REPRESSOR FAMILY
63711912.9190.0277864.4747
VLAGGKSGV
show
1JBJA
CD3 EPSILON AND GAMMA ECTODOMAIN FRAGMENTCOMPLEX
7511514112.850.3367627.955
LKARVGSADDAKKDAAKKDDAKKDDAKKDGSQTNKAKNLVQ
show
1JBJA
CD3 EPSILON AND GAMMA ECTODOMAIN FRAGMENTCOMPLEX
1161242910.4440.0501745.6768
VDGSRGDGS
show
1JEQA
KU70
2502571820.8080.0150734.7576
ETRKRALS
show
1JEQA
KU70
262268274.2790.0170553.9646
KLNKDIV
show
1JEQA
KU70
52956133324.3390.0398721.495
VYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSE
show
1JEQA
KU70
570573447.8280.00516142.2677
KGTL
show
1JEYB
KU80
2402471821.7120.0273752.899
IERHSIHW
show
1JFKA
CALCIUM-BINDING PROTEIN
6371196.730.0757275.1616
GSIQGQDLS
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
1491541615.6530.00587423.1919
AWPEEV
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
1581662913.4840.00517825.2677
LEVTPNRPD
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
168170336.730.000167040.95455
LGL
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
18019341436.280.026036.6414
LGYALVEPEAALKA
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
1942015817.6720.0133353.601
EALPLPFA
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
204212699.3290.0126675.6263
VEDPEGAPH
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
21922871023.4610.0101344.2576
FGLRVAPSPL
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
3623698815.9310.00595774.3333
RGVDPLGQ
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
384387948.8670.00481631.9747
AGAR
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
38939310510.4560.00793432.0808
AEALL
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
395404111027.8220.0193216.4394
AGSPKPPEAI
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
471483121334.9750.024365.1515
TIPLALPAFFPAP
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
48549013610.8930.00996663.3939
NRGVEA
show
1JJCB
PHENYLALANYL-TRNA SYNTHETASE BETA CHAIN
675693141939.7840.04618610.202
LPLPDKPLAFQDPSRHPAA
show
1JLXA
AGGLUTININ
153155135.3750.0126161.8283
DWK
show
1JS1X
TRANSCARBAMYLASE
1611681812.8410.0488245.2576
YKKTARPK
show
1JS1X
TRANSCARBAMYLASE
17218321214.3410.0256375.7929
TWAPHPRPLPQA
show
1JVSA
1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
141144149.0110.014382.7929
SKAQ
show
1JVSA
1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
2372422613.2580.0108172.4646
LFNASA
show
1JVSA
1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
2492553710.5980.00556462.7222
IHPQSVI
show
1JVSA
1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
261266465.9590.00531453.1212
YQDGSV
show
1JY1A
TYROSYL-DNA PHOSPHODIESTERASE
328333169.5870.0198872.8636
TAYNAP
show
1JY1A
TYROSYL-DNA PHOSPHODIESTERASE
34335321117.5180.0236325.5859
HKHDLSETNVY
show
1K0BD
URE2 PROTEIN
19620611117.850.0417425.4141
TGNPLLWSDDL
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
58631611.5360.0204283.4949
EAGVDR
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
6870236.6440.00650991.6263
DGL
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
7275347.4070.00617321.9697
HEGV
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
7982445.5420.0118411.7727
FAGQ
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
8688535.7550.00241321.101
IDL
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
92976611.0710.0126833.6061
SGGKTV
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
99102749.5190.00331111.5758
VYGQ
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
1151198510.7660.0152651.9293
ACGAT
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
121125959.8740.0120661.7424
VYQAA
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
1301381095.1730.0410244.8737
HDLQGERPY
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
1431461145.2010.0260962.9545
RDGE
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
1511541249.0060.00774451.7929
DCDY
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
15716613107.3760.0198664.4091
GCDGFHGISR
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
1681711448.6350.00881081.9697
SIPA
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
1731751537.0070.0167241.6818
RLK
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
190200161116.4650.0227855.4848
ADTPPVSHELI
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
2022091785.0650.0166683.7222
ANHPRGFA
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
2152181844.9940.0176222.1162
SATR
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
2252311979.8950.0281723.8384
VPLSEKV
show
1K0IA
P-HYDROXYBENZOATE HYDROXYLASE
2332362049.8820.0117852.3737
DWSD
show
1K1YA
4-ALPHA-GLUCANOTRANSFERASE
296301164.9440.0201774.6162
KEEGKF
show
1K1YA
4-ALPHA-GLUCANOTRANSFERASE
3083132616.0930.0016562.0606
VRGGIW
show
1K1YA
4-ALPHA-GLUCANOTRANSFERASE
3813893914.3270.0320745.899
QRYLKPENK
show
1K20A
MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
15216211112.0220.0359245.2929
TLLLKSPTTHP
show
1K20A
MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
175179259.3950.0175422.0657
AGVNL
show
1K32A
TRICORN PROTEASE
75076411526.2130.0219328.3737
MGGTFTDKDPFRSGR
show
1K32A
TRICORN PROTEASE
838844274.6770.016115.4697
SGKGGDK
show
1K32A
TRICORN PROTEASE
8508563715.4550.00858844.1111
DILDDDR
show
1K3YA
GLUTATHIONE S-TRANSFERASE A1
78861915.4160.058054.7222
KYNLYGKDI
show
1K5NA
MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2709
17418311018.5870.0459966.3838
NGKETLQRAD
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
355361179.3540.0116054.2172
DEGMITE
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
367370248.8270.00494942.0051
RIEA
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
377380348.4820.00628631.5909
LHPT
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
381383435.7970.00366941.5152
FNP
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
388391549.280.00847652.1414
AGEV
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
394396637.2080.00438051.2778
SAL
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
3994027410.0230.00253162.4949
SPGA
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
408411847.7430.00227561.0556
YFTA
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
419424969.8040.0141654.2222
EKGERV
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
4995041065.3130.00716814.298
DGSTGK
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
50751211614.4460.0110084.0152
KGDIET
show
1KBLA
PYRUVATE PHOSPHATE DIKINASE
51351912719.7720.0125734.2475
QEASVSG
show
1KITA
SIALIDASE
219224167.9350.00968073.3081
FRGPDR
show
1KJWA
POSTSYNAPTIC DENSITY PROTEIN 95
49952312534.8830.1399614.263
WSRLKAKDWGSSSGSQGREDSVLSY
show
1KJWA
POSTSYNAPTIC DENSITY PROTEIN 95
5305372817.510.0179283.2323
EVHYARPI
show
1KLOA
LAMININ
117119136.1030.0115021.8384
DKC
show
1KNXE
PROBABLE HPR(SER) KINASE/PHOSPHATASE
1311351510.3610.0198151.7374
QFATV
show
1KNYA
KANAMYCIN NUCLEOTIDYLTRANSFERASE
5763178.9260.0553554.7121
MSTEEAE
show
1KNYA
KANAMYCIN NUCLEOTIDYLTRANSFERASE
6974264.0770.0143133.5404
TTGEWK
show
1KNYA
KANAMYCIN NUCLEOTIDYLTRANSFERASE
8996389.7040.0336494.4343
ASQVESDW
show
1KNYA
KANAMYCIN NUCLEOTIDYLTRANSFERASE
103107459.7150.0150711.101
FFSIL
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
2932991713.0580.0164154.6616
ENNKINA
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
306310258.93802.4747
TNASL
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
3123183712.8120.0134182.8333
VRDDFAF
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
319322445.4870.0094452.5859
EDGL
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
323326546.6910.00416881.5404
FSGY
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
327332665.6620.0199654.3889
DAEKRQ
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
33335972721.7250.05276214.667
YDKSSWNYQLDENGYAKRDETLTHPRC
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
46947881012.6910.0151455.8283
TLPSEKQVDL
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
48549791312.0280.0202916.8535
NTPKATLADQVNY
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
5165191049.9360.00817482.4798
AAQK
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
527537111124.180.00905424.9495
WLPKWDQTYDV
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
54555112712.5160.0112044.6768
DEGKVTG
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
833876134438.1830.0353721.747
GRLFAINKMAEGPFPEHYEPIETPLGTNPLHPNVVSNPVVRLYE
show
1KQFA
FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
879890141218.9530.0271636.5152
ALRMGKKEQFPY
show
1KYFA
ALPHA-ADAPTIN C
8178221614.3330.00479522.6313
KLPITL
show
1KZLA
RIBOFLAVIN SYNTHASE
869911411.6680.0867185.601
RAVLSSTRMGGHFV
show
1L0QA
SURFACE LAYER PROTEIN
251257175.8060.0239664.8081
VTPDGKK
show
1L0QA
SURFACE LAYER PROTEIN
2622672615.1250.0208372.1364
LSFCNT
show
1L0QA
SURFACE LAYER PROTEIN
272277365.5580.0213383.3687
DTATNT
show
1L0QA
SURFACE LAYER PROTEIN
283288469.680.0181473.6414
AVGKNP
show
1L0QA
SURFACE LAYER PROTEIN
2892955713.0960.0192732.7323
YASGQFI
show
1L0QA
SURFACE LAYER PROTEIN
29730961330.4190.0344166.1061
SIPVQPVYPSADF
show
1L0QA
SURFACE LAYER PROTEIN
3113177710.8390.0264063.5152
SNITSGY
show
1L0QA
SURFACE LAYER PROTEIN
319324869.5140.0219642.7576
FLSEPV
show
1L5JA
ACONITATE HYDRATASE 2
310315165.3280.0105123.5859
YPYKGE
show
1L5JA
ACONITATE HYDRATASE 2
318324276.7230.0190234.1465
NHETGEL
show
1L5JA
ACONITATE HYDRATASE 2
3273343818.8530.0176774.0758
TFELKTDV
show
1L5JA
ACONITATE HYDRATASE 2
341344447.1450.00131412.2121
AGGR
show
1L5JA
ACONITATE HYDRATASE 2
36038452538.6860.06360712.631
ALGLPHSDVFRQAKDVAESDRGFSL
show
1LBUA
MURAMOYL-PENTAPEPTIDE CARBOXYPEPTIDASE
7783174.7080.0311624.3687
QDDDCTP
show
1LC3A
BILIVERDIN REDUCTASE A
1151201611.4120.0258883.1313
QKGRVL
show
1LC3A
BILIVERDIN REDUCTASE A
123125236.1040.00243731.3283
EHV
show
1LC3A
BILIVERDIN REDUCTASE A
128130336.6270.0103421.3586
LME
show
1LC3A
BILIVERDIN REDUCTASE A
139144468.0320.0258223.0505
VLGKEL
show
1LDKB
CULLIN HOMOLOG
5896021143.6150.032546.1919
ELVTNCFKNRYTLQ
show
1LDKB
CULLIN HOMOLOG
6106202119.60.0236124.7424
ILLQYNTEDAY
show
1LDKB
CULLIN HOMOLOG
626633386.6780.0266864.5152
TDSTQIKM
show
1LDKB
CULLIN HOMOLOG
64566842414.5660.0927914.293
KSKLLVLEDENANVDEVELKPDTL
show
1LDKB
CULLIN HOMOLOG
66969152322.1910.08361811.98
IKLYLGYKNKKLRVNINVPMKTE
show
1LDKB
CULLIN HOMOLOG
700702634.8950.0114161.9596
HKN
show
1LEHA
LEUCINE DEHYDROGENASE
1331381613.3150.01162.8131
VTGISP
show
1LEHA
LEUCINE DEHYDROGENASE
143146249.020.0130412.8182
SGNP
show
1LJ8A
MANNITOL DEHYDROGENASE
188195185.9040.00799754.1313
SCDNLPHN
show
1LJ8A
MANNITOL DEHYDROGENASE
210212237.0670.0103281.3636
HNA
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
14015211314.4470.0217885.7222
SEGLLPLDNHYHF
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
153156245.2630.000575142.6111
FNDK
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
1571633714.9010.00250363.3485
SLATFDS
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
165167436.4070.00405981.2727
LLE
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
1741875144.7770.0172549.5606
ESPVDSEQRGENDL
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
194201688.1980.0177965.5606
RPKSTEKL
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
20721671019.8960.0114354.6818
ASPYHLGIND
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
22223681530.2880.0338998.1818
ALHDMNVELEEKTSH
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
23725792155.2180.06972712.283
EIHVEQKLPQKLSAKAKELPI
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
258272101531.4140.0388056.4646
VDKAPYRFTHGWTYS
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
2782831165.590.000236822.2525
LTRGFA
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
287304121815.3420.00541319.3687
VAGVGTRSSDGFQTSGDY
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
3173231379.5140.0118753.3838
LNGRARA
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
3243321494.3070.0167135.5
YTSRKKTHE
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
33333815612.3630.00849182.6414
IKASWA
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
3473491636.2650.00199611.8434
KSY
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
3583651787.3540.00859333.8788
ATTGVEGL
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
37137618614.3090.000372153.5556
EAGISS
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
382398191710.5490.00954069.7778
RENGLVRSPGGFPGEDL
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
4054072035.2343.3832E-51.3131
TYS
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
4104122136.3250.00510861.6263
LDG
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
43344222109.8770.013336.2222
LDRKSGDYNQ
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
4454482345.1630.00328172.3131
HDRN
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
45545924511.960.0082553.3687
KVKAD
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
465474251011.190.00375535.3232
GLQDWNVTPE
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
48248926811.4170.0165784.5303
ALPEGHAK
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
494509271611.4790.00592066.3535
HRGAHIYMNSWQSIDF
show
1LNSA
X-PROLYL DIPEPTIDYL AMINOPETIDASE
521533281322.1970.0266266.0202
LLDRDLNLNLPPV
show
1LSHA
LIPOVITELLIN (LV-1N, LV-1C)
5565611613.8540.00646794.2626
ESKPSV
show
1LSHA
LIPOVITELLIN (LV-1N, LV-1C)
571577279.4940.0150053.7828
LRREPNL
show
1LSHA
LIPOVITELLIN (LV-1N, LV-1C)
5905963711.8490.00615874.2929
LSRSSNP
show
1LSHA
LIPOVITELLIN (LV-1N, LV-1C)
6096154711.8080.0131973.8737
IKMLGSK
show
1LSHA
LIPOVITELLIN (LV-1N, LV-1C)
6186255811.5970.0143393.702
RLGCRYSK
show
1LSLA
THROMBOSPONDIN 1
47349312138.3010.151519.1616
INGGWGPWSPWDICSVTCGGG
show
1LUAA
METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
11312211015.5910.0497876.5859
AAGGSVKGKK
show
1LUAA
METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
1261312612.5240.0127133.0455
LAGTGP
show
1LWTA
ENDONUCLEASE PI-SCEI
113119175.4260.0237754.2475
KAPDGRI
show
1LWTA
ENDONUCLEASE PI-SCEI
1261292410.3640.0123372.5707
VSKS
show
1LWTA
ENDONUCLEASE PI-SCEI
134137347.8090.0119953.2929
EGPE
show
1LWTA
ENDONUCLEASE PI-SCEI
1471544811.0960.0367974.904
RKASNKAY
show
1LWTA
ENDONUCLEASE PI-SCEI
155158549.7480.00903871.4848
FEWT
show
1LWTA
ENDONUCLEASE PI-SCEI
166169649.3540.00783931.6717
LLGS
show
1LWTA
ENDONUCLEASE PI-SCEI
173176747.9750.00955282
KATY
show
1LWTA
ENDONUCLEASE PI-SCEI
17918881024.3260.0198344.4091
YAPILYENDH
show
1LWTA
ENDONUCLEASE PI-SCEI
297300945.6750.0157642.6061
KDGV
show
1LY2A
COMPLEMENT RECEPTOR TYPE 2
64701714.2410.0793843.4697
YFNKYSS
show
1M3EB
SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
23226213113.3290.09516820.076
KGEKYEKRIERLSVRKEEDVKTRSGKLGDNV
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
213215136.5170.000797811.101
LID
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
217221259.2360.00356352.2879
ARTPL
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
2262313612.9220.0118343.6667
QAAKST
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
24126442411.3550.04169913.374
VRTLKAEKDYTYDIKTKAVQLTEE
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
267270545.2090.00577082.8333
TKAE
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
27228261111.6970.0199454.9495
AFGIDNLFDVK
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
2983027510.5290.00856312.4545
VAMQK
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
307314885.0930.0116483.6465
VVEDGQVV
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
31633091514.6560.0259827.3081
VDSFTGRLMKGRRYS
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
340349101022.140.016866.9091
KEGLEIQNES
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
3553571136.6500.64141
ITF
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
3613661268.9120.0102652.9091
FRMYEK
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
3713751359.9540.00226052.9848
TGTAK
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
38538914510.8750.00646231.904
YNMQV
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
391401151120.3650.0189085.399
TIPTNRPVVRD
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
40240616511.8060.00672823.0707
DRPDL
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
4084111747.3320.00523891.3636
YRTM
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
4264321877.3360.008513.0202
YMTGQPV
show
1M6NA
PREPROTEIN TRANSLOCASE SECA
4364391947.6220.00356351.1465
TVAV
show
1M70A
CYTOCHROME C4
109111136.5460.0084792.2828
GGK
show
1M70A
CYTOCHROME C4
114116235.5430.0161211.5556
QGM
show
1M98A
ORANGE CAROTENOID PROTEIN
15918412633.1980.1284513.601
VDMGFDTSKLGSYQRVAEPVVPPQEM
show
1M98A
ORANGE CAROTENOID PROTEIN
1861922719.6220.0446593.5909
QRTKVQI
show
1M98A
ORANGE CAROTENOID PROTEIN
193195335.8050.0150991.7374
EGV
show
1MG7B
EARLY SWITCH PROTEIN XOL-1 2.2K SPLICE FORM
185189157.5270.0216223.803
GSREE
show
1MIWA
TRNA CCA-ADDING ENZYME
138140135.6240.0141291.1667
RRI
show
1MIWA
TRNA CCA-ADDING ENZYME
1411472710.7770.0150573.2525
IRTVGEA
show
1MIWA
TRNA CCA-ADDING ENZYME
153156349.0750.00742542.3485
EDAL
show
1MIWA
TRNA CCA-ADDING ENZYME
2172314157.9650.0301668.1768
ETGLNAYLPGLAGKE
show
1MIWA
TRNA CCA-ADDING ENZYME
239242548.5490.0115511.0556
AYRW
show
1MJEA
BREAST CANCER 2
2707273613017.3260.04240513.828
ARWHSRLGFFRDPRPFPLPLSSLFSDGGNV
show
1MJEA
BREAST CANCER 2
274627512616.1720.00598961.8232
VYPLQW
show
1MJEA
BREAST CANCER 2
27542760374.9050.0214733.2475
KTVSGLY
show
1MJEA
BREAST CANCER 2
297329774511.7740.00583031.8788
SLHFS
show
1MJEA
BREAST CANCER 2
2980299151214.040.0264436.697
SDPAFQPPCSEV
show
1MJEA
BREAST CANCER 2
299930116135.2990.0264755.1919
SVVKPIGLAPLVY
show
1MKMB
ICLR TRANSCRIPTIONAL REGULATOR
7276158.5160.0305741.9899
LRRFN
show
1MKMB
ICLR TRANSCRIPTIONAL REGULATOR
9095269.40.0252494.0657
KRTGET
show
1MKMB
ICLR TRANSCRIPTIONAL REGULATOR
102105345.4060.0188082.4848
DGFE
show
1MKMB
ICLR TRANSCRIPTIONAL REGULATOR
11212741616.7940.0804718.596
VEGEQSIPMVSRLGMK
show
1MPYA
CATECHOL 2,3-DIOXYGENASE
12515012615.2970.1187513.146
YTGKWGLNDVNPEAWPRDLKGMAAVR
show
1MROA
METHYL-COENZYME M REDUCTASE
2712781811.4160.00332555.4747
RARGENEP
show
1MROA
METHYL-COENZYME M REDUCTASE
280283249.4668.111E-51.5657
GVPF
show
1MROA
METHYL-COENZYME M REDUCTASE
289292349.1360.000162221.5152
ICQS
show
1MROA
METHYL-COENZYME M REDUCTASE
2953004610.8750.036583.5101
VNYEDP
show
1MUNA
ADENINE GLYCOSYLASE
19019911010.8170.0623094.8232
MICTRSKPKC
show
1MXGA
ALPHA AMYLASE
346350155.1720.0153243.4697
YDNDE
show
1MXGA
ALPHA AMYLASE
3553642105.120.0312056.0202
RNGDSRRPGL
show
1N4MA
RETINOBLASTOMA POCKET
5785841711.4510.0296114.7828
TREGKST
show
1NBFA
UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 7
5275331717.1520.0232272.803
VLQAVTD
show
1NBQA
JUNCTIONAL ADHESION MOLECULE 1
1251281410.0730.0134721.4091
KLIV
show
1NBQA
JUNCTIONAL ADHESION MOLECULE 1
13014221334.5230.0356787.6667
VPPSKPTVNIPSS
show
1NBQA
JUNCTIONAL ADHESION MOLECULE 1
144149368.2810.0372572.8838
TIGNRA
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
12413311014.6580.0163295.0101
LLQERQDNLL
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
24825921222.0920.0158495.202
QRTTLPHIRSIT
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
260263349.7220.00669552.6869
MERE
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
266268436.1080.000904030.94949
SII
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
269271536.520.00132781.4747
MDA
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
5645716820.4630.0108773.1616
TLNYTCPT
show
1NG9A
DNA MISMATCH REPAIR PROTEIN MUTS
572578779.2470.010823.4899
FIDKPGI
show
1NHSA
NADH PEROXIDASE
234237149.1930.00606482.2172
DADL
show
1NHSA
NADH PEROXIDASE
2402442510.4440.00813571.4545
VAVGV
show
1NHSA
NADH PEROXIDASE
246249347.9970.00769192.3333
PNTA
show
1NHSA
NADH PEROXIDASE
25127642612.1970.06676214.141
LKGTLELHPNGLIKTDEYMRTSEPDV
show
1NHSA
NADH PEROXIDASE
278280537.2380.000246541.1818
AVG
show
1NHSA
NADH PEROXIDASE
283285636.6380.00197230.74242
TLI
show
1NHSA
NADH PEROXIDASE
290292735.4860.00971351.702
ADT
show
1NHSA
NADH PEROXIDASE
2942998614.8710.0100091.9444
VNIALA
show
1NHSA
NADH PEROXIDASE
31132791725.6390.04097410.717
KNLEEPVKPFPGVQGSS
show
1NHYA
ELONGATION FACTOR 1-GAMMA 1
73771510.3070.0332933.202
LSQDD
show
1NHYA
ELONGATION FACTOR 1-GAMMA 1
83902813.1170.0433594
LLGADDDL
show
1NIJA
HYPOTHETICAL PROTEIN YJIA
15816711013.0130.0482156.2727
TKTDVAGEAE
show
1NIJA
HYPOTHETICAL PROTEIN YJIA
1761822711.7410.00590653.0455
INARAPV
show
1NIJA
HYPOTHETICAL PROTEIN YJIA
1841923914.7750.0424373.8788
TVTHGDIDL
show
1NIJA
HYPOTHETICAL PROTEIN YJIA
19521842430.0180.1106210.46
LFNTNGFMLEENVVSTKPRFHFIA
show
1NIJA
HYPOTHETICAL PROTEIN YJIA
221224549.230.0119412.3434
QNDI
show
1NKGA
RHAMNOGALACTURONASE B
22924111321.9510.0416147.8384
SRSGTPSTSIDTS
show
1NKGA
RHAMNOGALACTURONASE B
24525421011.7680.0313284.6414
DLDIKGYVAA
show
1NKGA
RHAMNOGALACTURONASE B
322327367.2810.0175963.0859
VSAGST
show
1NKGA
RHAMNOGALACTURONASE B
3293324410.290.0148812.3131
TKNI
show
1NKGA
RHAMNOGALACTURONASE B
3333415922.7520.0316945.2626
SGSVKTGTT
show
1NUIA
DNA PRIMASE/HELICASE
3642176.5970.0627072.2424
CYVCEKW
show