SynLinker BLAST
       
Help
Search SynLinker using a linker sequence, to find out if a linker sequence is in the database.
Sequences should be at least 5 residues long, and should only contain unambiguous amino acids.

Example SynLinker BLAST Results
This is an example output from BLASTing: QHPPKDSSGQRVAVSPTSQRLQLLEPFDKWDGKDLKKLKSAVKLPNVLSSTRMGGHFV.

Click on headers to sort table. Hold shift to sort by multiple headers at once. Hover over a hit to get more information about the linker.
This website requires Javascript in order show the linker conformation, and to add linkers to your list of favorites.

LinkerDB ID Significance Sequence Alignment Structure Selected
Linkers
Accession ID Bit Score Evalue LabelFromSequenceTo Show/
Hide
Add/
Remove
1C96A274.3295.1274E-22
Query
Match
Linker
1

1
QHPPKDSSGQRVAVSPTSQRLQLLEPFDKWDGKDL
QHPPKDSSGQRVAVSPTSQRLQLLEPFDKWDGKDL
QHPPKDSSGQRVAVSPTSQRLQLLEPFDKWDGKDL
35

35
show
1KZLA128.4917.7388E-5
Query
Match
Linker
47

3
VLSSTRMGGHFV
VLSSTRMGGHFV
VLSSTRMGGHFV
58

14
show
3HSIB325.4090.00088746
Query
Match
Linker
38

6
LKSAVKLPNVLS
LKSAVKLPNVLS
LKSAVKLPNVLS
49

17
show
1H6TA916.9351.7105
Query
Match
Linker
33

2
KDLKKLKS
KDLKKLKS
KDLKKLKS
40

9
show


© 2013-2019 SynCTI, National University of Singapore (NUS). All Rights Reserved.
SynLinker is free for academic and non-commercial use. For a commercial license please contact us.
The project is partly supported by the Next-Generation BioGreen 21 Program (SSAC, No. PJ01109405), RDA, Republic of Korea.
This page requires Chrome 32, Firefox 26, or Internet Explorer 9 (without compatibility mode).